PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_19553
Common NameKK1_020126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 221aa    MW: 24913.4 Da    PI: 10.2242
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_19553genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-151360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++l+d+++ +G g+W + ++  g++R++k+c++rw +yl
    C.cajan_19553 13 KGAWSKQEDQKLIDYIRTHGAGRWCSLPKAAGLHRCGKSCRLRWINYL 60
                     79********************************************97 PP

2Myb_DNA-binding51.42.5e-1666110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++
    C.cajan_19553  66 RGNFAQDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 110
                      8999******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-23463IPR009057Homeodomain-like
PROSITE profilePS5129415.924860IPR017930Myb domain
SuperFamilySSF466891.45E-2811107IPR009057Homeodomain-like
SMARTSM007174.8E-141262IPR001005SANT/Myb domain
PfamPF002495.0E-141360IPR001005SANT/Myb domain
CDDcd001672.19E-111560No hitNo description
PROSITE profilePS5129426.27461115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2564116IPR009057Homeodomain-like
SMARTSM007175.1E-1565113IPR001005SANT/Myb domain
PfamPF002491.2E-1466110IPR001005SANT/Myb domain
CDDcd001676.09E-1168111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MRKPCCDKEG TNKGAWSKQE DQKLIDYIRT HGAGRWCSLP KAAGLHRCGK SCRLRWINYL  60
RPNIKRGNFA QDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH IRRKLIKMGI  120
DPNNHKLHQT FPVPKPCHIS RPASTAQSSA NNDRISDTHS CLAEETATTL SSTPHLNLDL  180
TIAFPSSPAH ALLQHKSKPT TTRNIIHDHQ DSAPTGLLLF L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-291211526128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007033078.11e-104Myb domain protein 6
SwissprotP813931e-71MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A151U9B21e-165A0A151U9B2_CAJCA; Myb-related protein 308
STRINGVIT_14s0006g01620.t017e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.18e-72myb domain protein 4